royalchimneysweepserviceshallandalebeach.shop
Raw vendor data — not score dimensions
3 of the 5 vendor metrics this card tracks have data for this domain
Current Price
$15
Starting Price
—
Price Change
Total Bids
0
Raw supplier metrics. Coverage is sparse and each column comes from a single supplier, so the score only uses them as a capped bonus of up to 8 points.