101kampanyaalimfirsatcilari.click
Raw vendor data — not score dimensions
1 of the 5 vendor metrics this card tracks have data for this domain
Estimated by the marketplace that lists this domain, not by Namester. It is that vendor's price guess and has nothing to do with the Namester Score, which ranks demand rather than price.
Current Price
$0
Starting Price
$8
Price Change
Total Bids
0
Raw supplier metrics. Coverage is sparse and each column comes from a single supplier, so the score only uses them as a capped bonus of up to 8 points.